188 avidin biotin peroxidase complex (Vector Laboratories)
Vector Laboratories is a verified supplier 
Vector Laboratories manufactures this product 
96
Structured Review
Vector Laboratories
188 avidin biotin peroxidase complex
188 Avidin Biotin Peroxidase Complex, supplied by Vector Laboratories, used in various techniques. Bioz Stars score: 96/100, based on 1047 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/avidin+biotin+peroxidase+complex+kit/VECTASTAIN+ABC+HRP+Kit+(Peroxidase%2C+Rabbit+IgG+)/pm42809441-88-29-36
Average 96 stars, based on 1047 article reviews
188 Avidin Biotin Peroxidase Complex, supplied by Vector Laboratories, used in various techniques. Bioz Stars score: 96/100, based on 1047 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/avidin+biotin+peroxidase+complex+kit/VECTASTAIN+ABC+HRP+Kit+(Peroxidase%2C+Rabbit+IgG+)/pm42809441-88-29-36
Average 96 stars, based on 1047 article reviews
188 avidin biotin peroxidase complex - by Bioz Stars,
2026-10
96/100 stars
Images
Related Articles
Avidin-Biotin Assay:Article Title: Low-dose metformin requires brain Rap1 for its antidiabetic action Article Snippet: The sections were then incubated with c-Fos antibody (1:1000; Synaptic Systems, 226003) or GFP antibody (1:1000; Aves Labs, NC9510598) in 3% normal donkey serum in PBT with 0.02% sodium azide for 48 to 72 hours. .. They were then treated with biotinylated secondary antibody against rabbit immunoglobulin G (1:1000; Vector Laboratories, BA-1000) or the Article Title: Successful Treatment of an Acinar Pancreatic Carcinoma in an Inland Bearded Dragon ( Pogona vitticeps ): A Case Report Article Snippet: .. Signal enhancement was achieved with the Article Title: Distinct roles of two thalamostriatal systems in learning processes of visual discrimination in common marmosets Article Snippet: Then the sections were incubated with species-specific IgG antibodies conjugated to biotin (for rabbit, 1:500, #711-065-152; Jackson ImmunoResearch Labs, West Grove, PA, USA or for goat, 1:500, #711-065-147; Jackson ImmunoResearch Labs), Cy3 (for guinea pig, 1:500, #706-165-148; Jackson ImmunoResearch Labs), Alexa 488 (for rabbit, 1:500, #A-21206; Thermo Fisher Scientific, Waltham, MA, USA) or Alexa 647 (for mouse, 1:500, #A-31571; Thermo Fisher Scientific) for 2 h at room temperature. .. The sections were treated with an Article Title: Symptomatic treatment by a BBB-permeable AAV engineered to restore TDP-43 function slows motor neuron disease and prevents paralysis Article Snippet: Then, the sections were washed three times with 1X PBS containing 1% Tween-20 (PBST) followed by incubation in biotinylated secondary antibodies (Anti-Mouse IgG, Ref#BP-9200 and Anti-Rabbit IgG, Ref#BP-9100, Vector laboratories) diluted in blocking buffer at room temperature for 1 hour. .. Sections were washed three times with PBS-T and incubated with Article Title: Low-dose metformin requires brain Rap1 for its antidiabetic action. Article Snippet: The sections were then incubated with c- Fos antibody (1:1000; Synaptic Systems, 226003) or GFP antibody (1:1000; Aves Labs, NC9510598) in 3% normal donkey serum in PBT with 0.02% sodium azide for 48 to 72 hours. .. They were then treated with biotinylated secondary antibody against rabbit immunoglobulin G (1:1000; Vector Laboratories, BA- 1000) or the Article Title: Distinct roles of two thalamostriatal systems in visually triggered decision-making in common marmosets Article Snippet: For expression of glutathione S-transferase fusion proteins, cDNA fragment encoding cgfTagRFP (MVSKGEELIKE NMHMKLYMEGTVNNHHFKATSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGMLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMALKLVGGGHLIVNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYSDLPSKLGH) was subcloned into the pGEX4T-2 plasmid (GE Healthcare, Chicago, IL). .. The sections were treated with an Article Title: Prenatal ethanol and cannabis exposure have sex- and region-specific effects on somatostatin and neuropeptide Y interneurons in the rat hippocampus. Article Snippet: Following this was a 2- h 2°C incubation in a 1:500 dilution of biotinylated goat α- rabbit (GenTex GTX71935) at room temperature in 3% NGS and 0.5% PBST. .. An other:Article Title: Targeting of specific neuronal types in the non-human primate brain by using a murine CD25-specific recombinant immunotoxin. Article Snippet: For immunohistochemistry, the sections were incubated overnight at 4°C with either an anti-TH monoclonal antibody (mouse, 1:400; Chemicon, Cat#MAB5280) or an anti-V5 monoclonal antibody (mouse, 1:100; Thermo Fisher Scientific, Cat#R960-25). Incubation:Article Title: Symptomatic treatment by a BBB-permeable AAV engineered to restore TDP-43 function slows motor neuron disease and prevents paralysis Article Snippet: Then, the sections were washed three times with 1X PBS containing 1% Tween-20 (PBST) followed by incubation in biotinylated secondary antibodies (Anti-Mouse IgG, Ref#BP-9200 and Anti-Rabbit IgG, Ref#BP-9100, Vector laboratories) diluted in blocking buffer at room temperature for 1 hour. .. Sections were washed three times with PBS-T and incubated with |